PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g26110.2.p
Common NameBRADI_5g26110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 330aa    MW: 34067.8 Da    PI: 6.1817
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g26110.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.52.7e-072270245
                      SSS-HHHHHHHHHHHHHTTTT......-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding  2 grWTteEdellvdavkqlGgg......tWktIartmgkgRtlkqcksrwq 45
                      g WT e ++ + +av+  G +       W+  a+ +  g+t+++++ ++ 
  Bradi5g26110.2.p 22 GGWTREQEKAFENAVAAAGEEapegdaAWEEMAAAVE-GKTAEEVRRHYE 70
                      67***********************************.**********95 PP

2Myb_DNA-binding21.94.1e-071702051247
                       HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++ + +++G+g+W++I+r +   Rt+ q+ s+ qky
  Bradi5g26110.2.p 170 FLLGLEKYGKGDWRSISRNFVISRTPTQVASHAQKY 205
                       777899***************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007174.9E-42075IPR001005SANT/Myb domain
PROSITE profilePS500906.6792273IPR017877Myb-like domain
SuperFamilySSF466891.15E-82379IPR009057Homeodomain-like
CDDcd001674.96E-52473No hitNo description
Gene3DG3DSA:1.10.10.609.9E-6129206IPR009057Homeodomain-like
CDDcd001672.30E-5137206No hitNo description
SMARTSM007170.066164208IPR001005SANT/Myb domain
TIGRFAMsTIGR015579.3E-11169208IPR006447Myb domain, plants
SuperFamilySSF466891.29E-9169211IPR009057Homeodomain-like
PfamPF002491.3E-5170205IPR001005SANT/Myb domain
PROSITE profilePS500904.739174206IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MAVEEASSSG GEEGSGSGSG SGGWTREQEK AFENAVAAAG EEAPEGDAAW EEMAAAVEGK  60
TAEEVRRHYE LLVEDVDGIE SGRVPLLVYA GDAAAAEEGG SGGGGGGKKG GGGGGGGHGE  120
KVSAAKSAEQ ERRKGIAWTE DEHRRCDQGT SIAVFFIKRK VDSNLGAWLF LLGLEKYGKG  180
DWRSISRNFV ISRTPTQVAS HAQKYFIRLN SMNRERRRSS IHDITSVNNG DTSAAQGPIT  240
GTNGQVANPG KSPKQPLQPA NPPPGVDAYG TTIGQPVGGP LVSAVGTPVS LPVPAPPHLA  300
YGMHAPVPGT VVPRAPINMP YPMPPPSSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-141689273RADIALIS
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1105113GGKKGGGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0939441e-135FP093944.1 Phyllostachys edulis cDNA clone: bphylf060p06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580818.21e-163PREDICTED: transcription factor DIVARICATA-like
TrEMBLA0A0Q3IGB10.0A0A0Q3IGB1_BRADI; Uncharacterized protein
STRINGBRADI5G26110.11e-163(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63763854
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.19e-71MYB family protein